PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00029061-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family G2-like
Protein Properties Length: 354aa    MW: 38818.9 Da    PI: 7.9575
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00029061-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.4e-32196251156
                G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                            k+r++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  SMil_00029061-RA_Salv 196 KARRCWSPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 251
                            68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.35193253IPR017930Myb domain
SuperFamilySSF466891.94E-18194254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28194254IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-27196251IPR006447Myb domain, plants
PfamPF002496.7E-8198249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MVIKDHNNHS DFSENMQRCH DYIKGLEEER CKIQVFQREL PLCLDLVTQA IETCRQQLSG  60
TTTDHNLHGQ SECSEQTSNH VPVFEEFMPI KRASPDSDGE EHESNKSKIN QTSDSNNDAK  120
ICQKSDWLRS VQLWNQTPDP PSKEDSATKF AASEVKTDGG GALKKERGVA APAPAPASTS  180
STAENGGGNK KESHRKARRC WSPELHRRFL QALQQLGGSH VATPKQIREL MKVDGLTNDE  240
VKSHLQKYRL HTRRPSSSTQ NNNAQTPQFV VVGGLWMPPD YASMATTTAS PGVTFSAPPP  300
PFQEPPSSPK RRQHIKPSSQ SNDGCSYSKG GAQSCSPATS SSTHTTTTAV SPAC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077211.11e-147PREDICTED: uncharacterized protein LOC105161268
TrEMBLD7T9871e-126D7T987_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g03110.t011e-125(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.19e-93G2-like family protein